PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn263221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family GRAS
Protein Properties Length: 581aa    MW: 65284.4 Da    PI: 4.8248
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn263221genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.86e-1362115802374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++lL++cA ++s+g+ + a+++++ l++++s +g+p++R+aay++eALaar+a s+++lykal+++e +   s ++l+a+++++ev+P+++f++++aN 
  Achn263221 211 KQLLYDCAVMISEGNIADASTVINDLRQRVSIQGSPTERIAAYMVEALAARVATSGKGLYKALKCKEPP---SNDRLSAMQVLFEVCPCFRFGFMAANG 306
                 589*****************************************************************9...9************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 aI ea + e+r+HiiDfdi+qG Q+++L+q+La++p++pp+lR+Tgv++pes+  s   l+ +g+rL+++A+el+v+fef++ va +++++++ +L+++
  Achn263221 307 AIIEASKDEKRIHIIDFDINQGSQYITLIQTLAKQPGKPPQLRLTGVDDPESVqrSVGGLKVIGQRLEELAKELKVQFEFRA-VAANTAEVNPAMLNCR 404
                 ***************************************************9988999************************.7999************ PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                  gEal+Vn+++qlh+++desvs+ ++rd++L++vks +Pk+v+vveq++++n+++Fl rf+ea +yysa++dsl+a+lpr+s++r +vE+++l+r+ivn
  Achn263221 405 AGEALIVNFAFQLHHMPDESVSTVNQRDQLLRMVKSFNPKLVTVVEQDVNTNTAPFLPRFAEAYNYYSAVYDSLDATLPRDSQDRLNVEKHCLARDIVN 503
                 *************************************************************************************************** PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 +vaceg+er+er e ++kWr+r+++aGFkp p+s+++++ ++ l++++ ++ y+v++esg+l + W+dr L+++SaWr
  Achn263221 504 IVACEGEERIERYELAGKWRARMMMAGFKPWPISSNVNELIRKLIKQYCDR-YKVKDESGALHFAWEDRVLIVASAWR 580
                 *************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.634184561IPR005202Transcription factor GRAS
PfamPF035142.1E-133211580IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MSLVRFQDQY ARSYGNPKLY ALNGSNDSPG ISTPIFNTEK HNKIMYATES CSSESYDLKY  60
FLDSPTEEFV HSSSYSNSEN PFHPQVRSTS MTALTPFNSF VAMQHQDPYQ ANFESEYLES  120
QSPDAVDYGE DEMRLKLREL ERALLDDNDV DEDDDAFGPD QSMEIDGEWA HPICNPLRHE  180
SPKESSSSDS NLSSISSTKE ISLTSSPQTP KQLLYDCAVM ISEGNIADAS TVINDLRQRV  240
SIQGSPTERI AAYMVEALAA RVATSGKGLY KALKCKEPPS NDRLSAMQVL FEVCPCFRFG  300
FMAANGAIIE ASKDEKRIHI IDFDINQGSQ YITLIQTLAK QPGKPPQLRL TGVDDPESVQ  360
RSVGGLKVIG QRLEELAKEL KVQFEFRAVA ANTAEVNPAM LNCRAGEALI VNFAFQLHHM  420
PDESVSTVNQ RDQLLRMVKS FNPKLVTVVE QDVNTNTAPF LPRFAEAYNY YSAVYDSLDA  480
TLPRDSQDRL NVEKHCLARD IVNIVACEGE ERIERYELAG KWRARMMMAG FKPWPISSNV  540
NELIRKLIKQ YCDRYKVKDE SGALHFAWED RVLIVASAWR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-5922958022375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015903103.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903104.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903105.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903106.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903107.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903109.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_015903110.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLW9RNG00.0W9RNG0_9R
STRINGPOPTR_0005s20890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1